PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.HB4AE
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ARR-B
Protein Properties Length: 544aa    MW: 60616.6 Da    PI: 6.4686
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.HB4AEgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.51.3e-27301355156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k +++WtpeLH++Fv+aveqL G ++A+P++il+lmkv+gLt+++v+SHLQkYR++
  Araip.HB4AE 301 KMKVDWTPELHKKFVKAVEQL-GLDQAIPSRILDLMKVEGLTRHNVASHLQKYRMH 355
                  5689*****************.********************************96 PP

2Response_reg25.75.7e-10211262109
                   EEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   2 livdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempg.mdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   l+ + + + +  ++  le  +y +v ++ d  eal  +  +   +++ ++ +++     G+++l++     ++lp i+ +     +++ +++ +Ga 
   Araip.HB4AE  21 LLLEGDAASAAEIKPKLEAMDY-NVSAFCDENEALSAISSRSesFHIAIVEVNINSgQGGFKFLENA----KDLPTIMTSNDHCLSTMMKCIALGAV 112
                   55666666677777789999**.***************665556**********9867888887643....3799999998889************* PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   +fl Kp ++e+l++
   Araip.HB4AE 113 EFLHKPLSEEKLRN 126
                   ***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521725.69E-1516135IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23003.3E-1616156No hitNo description
SMARTSM004489.1E-418128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011019.48719132IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.0E-820127IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.30E-921131No hitNo description
PROSITE profilePS5129414.402298357IPR017930Myb domain
SuperFamilySSF466894.93E-18299358IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.1E-27299358IPR009057Homeodomain-like
TIGRFAMsTIGR015571.7E-24301356IPR006447Myb domain, plants
PfamPF002492.3E-8304353IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MVCTVNDLQQ WKDFPKGLKV LLLEGDAASA AEIKPKLEAM DYNVSAFCDE NEALSAISSR  60
SESFHIAIVE VNINSGQGGF KFLENAKDLP TIMTSNDHCL STMMKCIALG AVEFLHKPLS  120
EEKLRNIWQH VVHKAFNASA SVMSESLKPV KESVVSMLQL QTDNEQQEST YTDDDPDPGS  180
DKYPAPSTPQ LNQGSRLMDD GDCQEQTNCS TEKESGEHDG EGESKSVETT CGNLNFESNN  240
TNEPMNTEKT LVKNLREDSR DGNHDSSVYK HTNDKVLSSD DGNTKSSNKV DSCTLKAHRK  300
KMKVDWTPEL HKKFVKAVEQ LGLDQAIPSR ILDLMKVEGL TRHNVASHLQ KYRMHKRQIL  360
PKEEGRKWLN QRDQMQRSYC LQQRPIMAFP PPNHSNHTLS PAPIYPMWRQ SGGQAAAMPV  420
WGPPGYPLWH PTESWHWKPL PGMHADAWGC PVLPPPQAPL PCFSYPLNVP GMHHTSAVDY  480
KSIMPQSSLD LHLAEEVVDK VVKEAISKPW LPLPLGLKPP STDSVLAELS RKGISTFPPC  540
SKGS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-16299359363ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016186772.10.0PREDICTED: two-component response regulator-like APRR2 isoform X2
SwissprotQ6LA431e-149APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A151QZG90.0A0A151QZG9_CAJCA; Two-component response regulator-like APRR2
STRINGGLYMA17G16360.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35663465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-141ARR-B family protein